PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g081860.1
Common NameMTR_5g081860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 272aa    MW: 31137.9 Da    PI: 7.7991
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g081860.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-13126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +  ++t+ q+ s+ qky
  Medtr5g081860.1 126 PWTEEEHRRFLMGLLKYGKGDWRNISRNFVVTKTPTQVASHAQKY 170
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.7162277IPR017884SANT domain
SMARTSM007173.8E-82375IPR001005SANT/Myb domain
SuperFamilySSF466892.01E-112579IPR009057Homeodomain-like
CDDcd001673.14E-62673No hitNo description
PROSITE profilePS5129420.215119175IPR017930Myb domain
SuperFamilySSF466893.45E-16121175IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-17122174IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.7E-11123169IPR009057Homeodomain-like
SMARTSM007175.6E-11123173IPR001005SANT/Myb domain
CDDcd001671.34E-8126170No hitNo description
PfamPF002494.9E-11126170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MDLETLYSPY FMLDTNWLVE ESYQTEWSRE DNKKFESALA IYDKDTPDRW LKVAEMIPGK  60
TVFDVIKQYR ELVEDVSEIE AGNVPIPGYL ASSFTFEVVE KQNYDGNRRR HVTVRGSDHE  120
RKKGVPWTEE EHRRFLMGLL KYGKGDWRNI SRNFVVTKTP TQVASHAQKY YIRQKVSSGG  180
KDKRRPSIHD ITTVTLTETS SPSENKSLLV NVSPMQQKMG WSTSHYNDGS PQGQDLYDCS  240
FHEAYAKLKV SGFATASRDF NKGAVFGIHA L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-18271021186RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.127530.0root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0519840.0BT051984.1 Medicago truncatula clone MTYF9_FA_FB_FC1G-K-6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616568.10.0MYB transcription factor MYB51
SwissprotQ8S9H73e-80DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLG7KBX00.0G7KBX0_MEDTR; MYB transcription factor MYB51
STRINGGLYMA14G06750.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-87MYB family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]